Name :
GFRA3 (Human) Recombinant Protein
Biological Activity :
Human GFRA3 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
O60609
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=2676
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSDPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLAHQNENPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMRKAYGEACSG
Molecular Weight :
40.7
Storage and Stability :
Store at 4°C for 2-4 weeks and should be stored at -20°C to -80°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
chromatographic
Quality Control Testing :
Storage Buffer :
Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.4 M urea.
Applications :
Functional Study，
Gene Name :
GFRA3
Gene Alias :
–
Gene Description :
GDNF family receptor alpha 3
Gene Summary :
The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. [provided by RefSeq
Other Designations :
GPI-linked receptor|glial cell line-derived neurotrophic factor receptor alpha-3
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Associated Protein/CD47 Recombinant Proteins
IFN-beta ProteinPurity & Documentation
Popular categories:
CD319/SLAMF7
Cathepsin S
