Name :
COL18A1 (Human) Recombinant Protein
Biological Activity :
Human COL18A1 (P39060, 1571 a.a. – 1754 a.a.) partial recombinant protein expressed in Pichia pastoris.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Protein Accession No. :
P39060
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=80781
Amino Acid Sequence :
AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Molecular Weight :
20.2
Storage and Stability :
Store at 4°C to 8°C for 1 week. For long term storage store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Yeast
Interspecies Antigen Sequence :
Preparation Method :
Pichia pastoris expression system
Purification :
Quality Control Testing :
Storage Buffer :
Lyophilized from sterile distilled Water up to 100 ug/ml
Applications :
Functional Study， SDS-PAGE，
Gene Name :
COL18A1
Gene Alias :
FLJ27325, FLJ34914, KNO, KNO1, MGC74745
Gene Description :
collagen, type XVIII, alpha 1
Gene Summary :
This gene encodes the alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. The proteolytically produced C-terminal fragment of type XVIII collagen is endostatin, a potent antiangiogenic protein. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities, so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations :
OTTHUMP00000115472|OTTHUMP00000115473|alpha 1 type XVIII collagen|antiangiogenic agent|endostatin|multi-functional protein MFP
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MIG/CXCL9 ProteinBiological Activity
FGF-16 ProteinBiological Activity
Popular categories:
IgM
Histidine-Proline-rich Glycoprotein (HPRG)
