Share this post on:

Name :
TGFB1 (Human) Recombinant Protein

Biological Activity :
Human TGFB1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :

Protein Accession No. :

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=7040

Amino Acid Sequence :
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight :

Storage and Stability :
Store at -20°C, lyophilized protein is stable for 1 year.After reconstitution with deionized water, store at -20 to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Ni-NTA chromatography

Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue

Storage Buffer :
Lyophilized from PBS, pH 8.0.

Applications :
Functional Study, The ED50 for this effect is SDS-PAGE,

Gene Name :
TGFB1

Gene Alias :
CED, DPD1, TGFB, TGFbeta

Gene Description :
transforming growth factor, beta 1

Gene Summary :
TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM

Other Designations :
TGF-beta 1 protein|diaphyseal dysplasia 1, progressive|transforming growth factor-beta 1

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin D ProteinSpecies
IL-34 web
Popular categories:
ACP5
FGF-16

Share this post on: