Name :
CCL19 (Human) Recombinant Protein
Biological Activity :
Human CCL19 (P55774) recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
P55774
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=6363
Amino Acid Sequence :
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Molecular Weight :
8.800000000000001
Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions
Storage Buffer :
No additive
Applications :
Functional Study， SDS-PAGE，
Gene Name :
CCL19
Gene Alias :
CKb11, ELC, MGC34433, MIP-3b, MIP3B, SCYA19
Gene Description :
chemokine (C-C motif) ligand 19
Gene Summary :
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq
Other Designations :
CC chemokine ligand 19|CK beta-11|EBI1-ligand chemokine|OTTHUMP00000000531|OTTHUMP00000021295|beta chemokine exodus-3|exodus-3|macrophage inflammatory protein 3-beta|small inducible cytokine A19|small inducible cytokine subfamily A (Cys-Cys), member 19
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Prolactin Recombinant Proteins
EDAR Proteinweb
Popular categories:
Pellino-1
Death-Associated Protein Kinase 1 (DAPK1)
