Share this post on:

Name :
AKR1C1 (Human) Recombinant Protein

Biological Activity :
Human AKR1C1 (NP_001344, 1 a.a. – 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins,Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

Tag :

Protein Accession No. :
NP_001344

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1645

Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Molecular Weight :
38.9

Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :
Conventional Chromatography

Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE

Storage Buffer :
In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 20% glycerol).

Applications :
Functional Study, SDS-PAGE,

Gene Name :
AKR1C1

Gene Alias :
2-ALPHA-HSD, 20-ALPHA-HSD, C9, DD1, DDH, DDH1, H-37, HAKRC, MBAB, MGC8954

Gene Description :
aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase)

Gene Summary :
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq

Other Designations :
20 alpha-hydroxysteroid dehydrogenase|OTTHUMP00000018992|aldo-keto reductase C|aldo-keto reductase family 1, member C1|chlordecone reductase homolog|dihydrodiol dehydrogenase 1|dihydrodiol dehydrogenase isoform DD1|hepatic dihydrodiol dehydrogenase|trans-

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IgE MedChemExpress
KGF/FGF-7 Proteincustom synthesis
Popular categories:
Estrogen Receptor
Cathepsin A

Share this post on: